PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.04G134000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family MYB_related
Protein Properties Length: 360aa    MW: 39309.6 Da    PI: 7.4166
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.04G134000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.38.6e-14115159347
                          SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
      Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                          +WT+eE+ l++ + ++lG+g+W+ Iar     Rt+ q+ s+ qky
  Manes.04G134000.1.p 115 PWTEEEHRLFLVGLQKLGKGDWRGIARNYVVSRTPTQVASHAQKY 159
                          8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.297108164IPR017930Myb domain
SuperFamilySSF466897.18E-17110165IPR009057Homeodomain-like
TIGRFAMsTIGR015576.1E-19111163IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.602.5E-11112158IPR009057Homeodomain-like
SMARTSM007174.3E-11112162IPR001005SANT/Myb domain
CDDcd001677.78E-10115160No hitNo description
PfamPF002491.8E-11115159IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MTRRCSHCSN NGHNSRTCPV RSSGASSTSA SSAVGVRLFG VRLTDGSIIK KSASMGNLSA  60
HYHSSSSAAA SPNPDSPSSD HVRDSGNVPE GYLSDDPVHA SSSTNRRGER KKGVPWTEEE  120
HRLFLVGLQK LGKGDWRGIA RNYVVSRTPT QVASHAQKYF IRQSNSTRRK RRSSLFDMVA  180
DMATEPQTVP EDQELPSFHL RERDNADSLP SLNLSLKPEY EPMETTTDEP GKEPDDTVTD  240
SSESKQTVPK LSAFNPTVPP LKDFTQDVPG FYSAYMPIPY PFWPANAASL EVKREETSNH  300
EVLKPVPTFP KQPVNVNELV GLSHLSIAET EREPSPLSLK LIGEPTRQSA FHANASAVG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012069084.10.0PREDICTED: myb-like protein H
TrEMBLA0A067KXJ70.0A0A067KXJ7_JATCU; Uncharacterized protein
STRINGGLYMA13G43120.11e-140(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77193346
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16350.13e-96MYB_related family protein